A pseudoscorpion clinging to a cave salamander: phoresy or failed predation?

Posted by
  A pseudoscorpion clinging to a cave salamander: phoresy or failed predation? Abstract Pseudoscorpions are well known for phoretic associations with arthropods, but interactions with amphibians are rarely documented. Here we report a pseudoscorpion attached to the left palpebral region of an adult male Italian cave salamander, Speleomantes italicus , observed during a visual survey in a karst cave in Tuscany, Italy. The pseudoscorpion, assigned on the basis of visible morphology and locality to Chthonius cf. elongatus , was grasping a minute cutaneous fold on the lower margin of the left upper eyelid with one chela while the salamander moved slowly over the rock surface. No handling was performed and the initial contact between the two animals was not observed. The event therefore cannot be interpreted unambiguously, but may represent opportunistic phoresy or defensive attachment following a failed predation attempt. To our knowledge, this is the first published observation of a ...

Discovery of a Novel Antithrombotic Cystine Knot Peptide from Spider Venom Gland Transcriptome

Posted by

 


Discovery of a Novel Antithrombotic Cystine Knot Peptide from Spider Venom Gland Transcriptome

Abstract

The development of effective anticoagulants remains a critical need in modern medicine, particularly for preventing and treating thromboembolic disorders, such as arterial thrombosis and deep vein thrombosis (DVT), as well as complications like ischemic stroke. This study identifies a cysteine-knotted peptide GC38 (sequence: GCSGKGARCAPSKCCSGLSCGRHGGNMYKSCEWNWKTG) derived from the venom gland transcriptome of the Macrothele sp. spider, which exerts thrombus-inhibitory effects by potentiating activated protein C (APC) activity. In vitro assays reveal that GC38 enhances APC activity, prolongs plasma clotting time, and shows no significant cytotoxicity or hemolytic activity. Mechanistically, GC38 interacts allosterically with APC; biolayer interferometry (BLI) confirms this direct interaction, with a dissociation constant KD of 6.16 μM. Additionally, three in vivo thrombosis models (FeCl3-induced arterial occlusion, stasis-induced DVT, and cortical photothrombotic stroke) consistently demonstrated that GC38 was effective in alleviating thrombus formation, with tail-bleeding assays confirming its low hemorrhagic risk. Collectively, our findings position GC38 as a pioneering spider venom-derived lead molecule that addresses dual arterial and venous antithrombotic actions. This opens new avenues for developing spider venom-derived peptides as therapeutic agents targeting intravascular coagulation in arteries and veins.

Gao, J., Yang, D., Wang, W., Huang, X., Guo, R., Cao, K., Lu, Q., Wang, Z., Lai, R., & Li, J. (2025). Discovery of a Novel Antithrombotic Cystine Knot Peptide from Spider Venom Gland Transcriptome. International Journal of Molecular Sciences, 26(20), 10154. https://doi.org/10.3390/ijms262010154