Soil Preference and Burrow Characteristics of Two Theraphosidae Species in Penang Island, Malaysia

Posted by
  Soil Preference and Burrow Characteristics of Two Theraphosidae Species in Penang Island, Malaysia Abstract Tarantulas play a crucial role in maintaining ecological balance by regulating insect populations. However, little is known about the soil preferences and burrow structures of tarantulas in Malaysia. This study aims to determine the soil preference as well as the burrow structure of  Coremiocnemis cunciularia  and  Chilobrachys andersoni  from Penang Island. The soil characteristics of the soil samples collected around the burrows of  Coremiocnemis cunciularia  (n = 30) and  Chilobrachys andersoni  (n = 30) were determined using soil texture analysis. The measurements and burrow structures from adults and juveniles of  Coremiocnemis cunciularia  and  Chilobrachys andersoni  were determined. It was revealed that the moisture content and clay percentage in the soil samples around burrows of  Chilobrachys anderso...

Discovery of a Novel Antithrombotic Cystine Knot Peptide from Spider Venom Gland Transcriptome

Posted by

 


Discovery of a Novel Antithrombotic Cystine Knot Peptide from Spider Venom Gland Transcriptome

Abstract

The development of effective anticoagulants remains a critical need in modern medicine, particularly for preventing and treating thromboembolic disorders, such as arterial thrombosis and deep vein thrombosis (DVT), as well as complications like ischemic stroke. This study identifies a cysteine-knotted peptide GC38 (sequence: GCSGKGARCAPSKCCSGLSCGRHGGNMYKSCEWNWKTG) derived from the venom gland transcriptome of the Macrothele sp. spider, which exerts thrombus-inhibitory effects by potentiating activated protein C (APC) activity. In vitro assays reveal that GC38 enhances APC activity, prolongs plasma clotting time, and shows no significant cytotoxicity or hemolytic activity. Mechanistically, GC38 interacts allosterically with APC; biolayer interferometry (BLI) confirms this direct interaction, with a dissociation constant KD of 6.16 μM. Additionally, three in vivo thrombosis models (FeCl3-induced arterial occlusion, stasis-induced DVT, and cortical photothrombotic stroke) consistently demonstrated that GC38 was effective in alleviating thrombus formation, with tail-bleeding assays confirming its low hemorrhagic risk. Collectively, our findings position GC38 as a pioneering spider venom-derived lead molecule that addresses dual arterial and venous antithrombotic actions. This opens new avenues for developing spider venom-derived peptides as therapeutic agents targeting intravascular coagulation in arteries and veins.

Gao, J., Yang, D., Wang, W., Huang, X., Guo, R., Cao, K., Lu, Q., Wang, Z., Lai, R., & Li, J. (2025). Discovery of a Novel Antithrombotic Cystine Knot Peptide from Spider Venom Gland Transcriptome. International Journal of Molecular Sciences, 26(20), 10154. https://doi.org/10.3390/ijms262010154