Integrative taxonomy of the genus Nesticus in central Japan, with the description of a new species and redescriptions of N. echigonus and N. gondai (Araneae, Nesticidae)

  Integrative taxonomy of the genus Nesticus in central Japan, with the description of a new species and redescriptions of N. echigonus and N. gondai (Araneae, Nesticidae) Abstract Species of the genus Nesticus ( Araneae , Nesticidae ) in central Japan are revised based on morphological and molecular analyses of specimens collected from Niigata and Gunma Prefectures. Among them, a putative undescribed species was discovered having clearly distinguishable morphological characters from other known species in the same area. A phylogenetic analysis based on the mitochondrial COI gene was carried out using a maximum-likelihood method to confirm its distinctiveness. The new species, Nesticus yamabushi sp. nov ., is described based on specimens of both sexes. Furthermore, we provide detailed redescriptions of two other closely related species, N. echigonus and N. gondai , to address the lack of information in their original descriptions and facilitate future identifications. This s...

Discovery of a Novel Antithrombotic Cystine Knot Peptide from Spider Venom Gland Transcriptome

 


Discovery of a Novel Antithrombotic Cystine Knot Peptide from Spider Venom Gland Transcriptome

Abstract

The development of effective anticoagulants remains a critical need in modern medicine, particularly for preventing and treating thromboembolic disorders, such as arterial thrombosis and deep vein thrombosis (DVT), as well as complications like ischemic stroke. This study identifies a cysteine-knotted peptide GC38 (sequence: GCSGKGARCAPSKCCSGLSCGRHGGNMYKSCEWNWKTG) derived from the venom gland transcriptome of the Macrothele sp. spider, which exerts thrombus-inhibitory effects by potentiating activated protein C (APC) activity. In vitro assays reveal that GC38 enhances APC activity, prolongs plasma clotting time, and shows no significant cytotoxicity or hemolytic activity. Mechanistically, GC38 interacts allosterically with APC; biolayer interferometry (BLI) confirms this direct interaction, with a dissociation constant KD of 6.16 μM. Additionally, three in vivo thrombosis models (FeCl3-induced arterial occlusion, stasis-induced DVT, and cortical photothrombotic stroke) consistently demonstrated that GC38 was effective in alleviating thrombus formation, with tail-bleeding assays confirming its low hemorrhagic risk. Collectively, our findings position GC38 as a pioneering spider venom-derived lead molecule that addresses dual arterial and venous antithrombotic actions. This opens new avenues for developing spider venom-derived peptides as therapeutic agents targeting intravascular coagulation in arteries and veins.

Gao, J., Yang, D., Wang, W., Huang, X., Guo, R., Cao, K., Lu, Q., Wang, Z., Lai, R., & Li, J. (2025). Discovery of a Novel Antithrombotic Cystine Knot Peptide from Spider Venom Gland Transcriptome. International Journal of Molecular Sciences, 26(20), 10154. https://doi.org/10.3390/ijms262010154